Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prostate stem cell antigen (Psca)

Product Specifications

Product Name Alternative

Psca; Prostate stem cell antigen

Abbreviation

Recombinant Mouse Psca protein

Gene Name

Psca

UniProt

P57096

Expression Region

21-95aa

Organism

Mus musculus (Mouse)

Target Sequence

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

May be involved in the regulation of cell proliferation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the regulation of cell proliferation.

Molecular Weight

10.4 kDa

References & Citations

Prostate stem cell antigen a cell surface marker overexpressed in prostate cancer.Reiter R.E., Gu Z., Watabe T., Thomas G., Szigeti K., Davis E., Wahl M., Nisitani S., Yamashiro J., le Beau M.M., Losa M., Witte O.N.Proc. Natl. Acad. Sci. U.S.A. 95:1735-1740 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Desulfitobacterium hafniense Glycerol-3-phosphate acyltransferase 2 (plsY2)
orb2912810-01 20 µg

Recombinant Desulfitobacterium hafniense Glycerol-3-phosphate acyltransferase 2 (plsY2)

Sign In for Pricing
View Details
Recombinant Desulfitobacterium hafniense Glycerol-3-phosphate acyltransferase 2 (plsY2)
orb2912810-02 100 µg

Recombinant Desulfitobacterium hafniense Glycerol-3-phosphate acyltransferase 2 (plsY2)

Sign In for Pricing
View Details
ADH1B Antibody
orb2681481-01 50 µL

ADH1B Antibody

Sign In for Pricing
View Details
ADH1B Antibody
orb2681481-02 100 µL

ADH1B Antibody

Sign In for Pricing
View Details
ADH1B Antibody
orb2681481-03 200 µL

ADH1B Antibody

Sign In for Pricing
View Details
UQCRFS1 (Cytochrome b-c1 Complex Subunit Rieske, Mitochondrial, Complex III Subunit 5, Cytochrome b-c1 Complex Subunit 5, Rieske iron-sulfur Protein, RISP, Ubiquinol-cytochrome c Reductase iron-sulfur Subunit) (HRP)
312797-01 50 µg

UQCRFS1 (Cytochrome b-c1 Complex Subunit Rieske, Mitochondrial, Complex III Subunit 5, Cytochrome b-c1 Complex Subunit 5, Rieske iron-sulfur Protein, RISP, Ubiquinol-cytochrome c Reductase iron-sulfur Subunit) (HRP)

Sign In for Pricing
View Details