Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prostate stem cell antigen (Psca)

Product Specifications

Product Name Alternative

Psca; Prostate stem cell antigen

Abbreviation

Recombinant Mouse Psca protein

Gene Name

Psca

UniProt

P57096

Expression Region

21-95aa

Organism

Mus musculus (Mouse)

Target Sequence

LQCYSCTAQMNNRDCLNVQNCSLDQHSCFTSRIRAIGLVTVISKGCSSQCEDDSENYYLGKKNITCCYSDLCNVN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

May be involved in the regulation of cell proliferation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be involved in the regulation of cell proliferation.

Molecular Weight

10.4 kDa

References & Citations

Prostate stem cell antigen a cell surface marker overexpressed in prostate cancer.Reiter R.E., Gu Z., Watabe T., Thomas G., Szigeti K., Davis E., Wahl M., Nisitani S., Yamashiro J., le Beau M.M., Losa M., Witte O.N.Proc. Natl. Acad. Sci. U.S.A. 95:1735-1740 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC061237 3'UTR Lenti-reporter-Luc Vector
13176084 1.0 µg

BC061237 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
EP pH Buffer Sol. pH 9.18 +/- 0.01 25C
EP918-100 100 mL

EP pH Buffer Sol. pH 9.18 +/- 0.01 25C

Sign In for Pricing
View Details
RPS2P38 sgRNA CRISPR Lentivector set (Human)
K2002801 3x 1.0 µg

RPS2P38 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rad9, phosphorylated (Ser387) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A)
MBS627741-01 0.2 mL

Rad9, phosphorylated (Ser387) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A)

Sign In for Pricing
View Details
Rad9, phosphorylated (Ser387) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A)
MBS627741-02 5x 0.2 mL

Rad9, phosphorylated (Ser387) (RAD9A, Cell Cycle Checkpoint Control Protein RAD9A, hRAD9, DNA Repair Exonuclease Rad9 Homolog A)

Sign In for Pricing
View Details
IFluor® 555 Anti-human CD3 Antibody *UCHT1*
10032090-AAT 100 Tests

IFluor® 555 Anti-human CD3 Antibody *UCHT1*

Sign In for Pricing
View Details