Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Serine protease 1 (Prss1)

Product Specifications

Product Name Alternative

Anionic trypsin IPretrypsinogen ISerine protease 1

Abbreviation

Recombinant Rat Prss1 protein

Gene Name

Prss1

UniProt

P00762

Expression Region

24-246aa

Organism

Rattus norvegicus (Rat)

Target Sequence

IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.6 kDa

References & Citations

Structure of two related rat pancreatic trypsin genes.Craik C.S., Choo Q.L., Swift G.H., Quinto C., MacDonald R.J., Rutter W.J.J. Biol. Chem. 259:14255-14264 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP112 Polyclonal Antibody
UB-GEN-7248 100 µL

GP112 Polyclonal Antibody

Sign In for Pricing
View Details
Slc16a12b Antibody
orb860496 2 mg

Slc16a12b Antibody

Sign In for Pricing
View Details
LRRK2 inhibitor 1 5mg
A19701-5 5 mg

LRRK2 inhibitor 1 5mg

Sign In for Pricing
View Details
HMHA1 3'UTR GFP Stable Cell Line
TU060005 1.0 mL

HMHA1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Polyclonal Antibody to Ephrin B2 (EFNB2)
TRV-0050116-01 20 µL

Polyclonal Antibody to Ephrin B2 (EFNB2)

Sign In for Pricing
View Details
Polyclonal Antibody to Ephrin B2 (EFNB2)
TRV-0050116-02 100 µL

Polyclonal Antibody to Ephrin B2 (EFNB2)

Sign In for Pricing
View Details