Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cardiac phospholamban (PLN)

Product Specifications

Product Name Alternative

Cardiac phospholamban; CMD1P; CMH18; PLB; Pln; PPLA_HUMAN

Abbreviation

Recombinant Human PLN protein

Gene Name

PLN

UniProt

P26678

Expression Region

1-52aa

Organism

Homo sapiens (Human)

Target Sequence

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca2+. Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca (2+) . Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation.

Molecular Weight

33.1 kDa

References & Citations

"Myotonic dystrophy protein kinase phosphorylates phospholamban and regulates calcium uptake in cardiomyocyte sarcoplasmic reticulum." Kaliman P., Catalucci D., Lam J.T., Kondo R., Gutierrez J.C., Reddy S., Palacin M., Zorzano A., Chien K.R., Ruiz-Lozano P.J. Biol. Chem. 280:8016-8021 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,4-Butane-2,2,3,3-d4-diamine 2HCl
TRC-D416022-2MG 2 mg

1,4-Butane-2,2,3,3-d4-diamine 2HCl

Sign In for Pricing
View Details
Cathepsin D Mouse Monoclonal Antibody [13F3]
EM1901-16 100 µL

Cathepsin D Mouse Monoclonal Antibody [13F3]

Sign In for Pricing
View Details
ZNF10 Antibody
OC-728-01 50 μL

ZNF10 Antibody

Sign In for Pricing
View Details
ZNF10 Antibody
OC-728-02 100 µL

ZNF10 Antibody

Sign In for Pricing
View Details
ZNF10 Antibody
OC-728-03 1 mL

ZNF10 Antibody

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF640R conjugate, 0.1mg/mL
BNC402730-100 1x 100 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details