Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Peptide deformylase (def)

Product Specifications

Product Name Alternative

Polypeptide deformylase

Abbreviation

Recombinant Staphylococcus aureus def protein

Gene Name

Def

UniProt

P68826

Expression Region

1-183aa

Organism

Staphylococcus aureus

Target Sequence

MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity) .

Molecular Weight

22.6 kDa

References & Citations

Staphylococcus aureus deformylase 1 encoding DNA.Lonetto M.A., Sylvester D.R., Warren R.L. Identification of Staphylococcus aureus proteins recognized by the antibody-mediated immune response to a biofilm infection.Brady R.A., Leid J.G., Camper A.K., Costerton J.W., Shirtliff M.E.Infect. Immun. 74:3415-3426 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Platelet Derived Growth Factor D (PDGFD) ELISA Kit
orb780958-01 48 Tests

Rat Platelet Derived Growth Factor D (PDGFD) ELISA Kit

Sign In for Pricing
View Details
Rat Platelet Derived Growth Factor D (PDGFD) ELISA Kit
orb780958-02 96 Tests

Rat Platelet Derived Growth Factor D (PDGFD) ELISA Kit

Sign In for Pricing
View Details
ZNF609 Antibody
orb1244012 100 µL

ZNF609 Antibody

Sign In for Pricing
View Details
Human ZNF433 Protein Lysate 20ug
IHUZNF433PLLY20UG 20 µg

Human ZNF433 Protein Lysate 20ug

Sign In for Pricing
View Details
Recombinant Human Heat shock factor protein 2 (HSF2)
orb3007540-01 20 µg

Recombinant Human Heat shock factor protein 2 (HSF2)

Sign In for Pricing
View Details
Recombinant Human Heat shock factor protein 2 (HSF2)
orb3007540-02 100 µg

Recombinant Human Heat shock factor protein 2 (HSF2)

Sign In for Pricing
View Details