Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat NADPH oxidase 4 (Nox4), partial

Product Specifications

Product Name Alternative

Kidney oxidase-1 ; KOX-1Kidney superoxide-producing NADPH oxidase

Abbreviation

Recombinant Rat Nox4 protein, partial

Gene Name

Nox4

UniProt

Q924V1

Expression Region

210-424aa

Organism

Rattus norvegicus (Rat)

Target Sequence

GGLLKYQTNLDTHPPGCISLNRTPSQNMSIADYVSEHFHGSLPGGFSKLEDHYQKTLVKICLEEPKFQAHFPQTWIWISGPLCLYCAERLYRCIRSNKPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Constitutive NADPH oxidase which generates superoxide intracellularly upon formation of a complex with CYBA/p22phox. Regulates signaling cascades probably through phosphatases inhibition. May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity. May regulate insulin signaling cascade. May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB.

Molecular Weight

40.6 kDa

References & Citations

Direct interaction of the novel Nox proteins with p22phox is required for the formation of a functionally active NADPH oxidase.Ambasta R.K., Kumar P., Griendling K.K., Schmidt H.H.H.W., Busse R., Brandes R.P.J. Biol. Chem. 279:45935-45941 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N2',N2'''-[Dithiobis(1-oxo-3,1-propanediyl)]bis[N2'-deacetyl- maytansine
TRC-D494185-25MG 25 mg

N2',N2'''-[Dithiobis(1-oxo-3,1-propanediyl)]bis[N2'-deacetyl- maytansine

Sign In for Pricing
View Details
Bis (2-Ethylhexyl) 4,4’-(6-(4-(ethoxycarbonyl)phenylamino)-1,3,5-triazine-2,4-diyl)bis(azanediyl)dibenzoate
TRC-B433845-100MG 100 mg

Bis (2-Ethylhexyl) 4,4’-(6-(4-(ethoxycarbonyl)phenylamino)-1,3,5-triazine-2,4-diyl)bis(azanediyl)dibenzoate

Sign In for Pricing
View Details
Sodium 6-Amino-4-hydroxy-3-((E)-(4-((E)-phenyldiazenyl)naphthalen-1-yl)diazenyl)naphthalene-2-sulfonate
TRC-S696980-250MG 250 mg

Sodium 6-Amino-4-hydroxy-3-((E)-(4-((E)-phenyldiazenyl)naphthalen-1-yl)diazenyl)naphthalene-2-sulfonate

Sign In for Pricing
View Details
Thallos AM - green fluorescent thallium indicator
1381G 3x 50 µg

Thallos AM - green fluorescent thallium indicator

Sign In for Pricing
View Details
2-Fluoroadenine
TRC-F587200-250MG 250 mg

2-Fluoroadenine

Sign In for Pricing
View Details
Human TCP10L activation kit by CRISPRa
GA115359 1 Kit

Human TCP10L activation kit by CRISPRa

Sign In for Pricing
View Details