Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein BEX3 (NGFRAP1)

Product Specifications

Product Name Alternative

Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death executor

Abbreviation

Recombinant Human NGFRAP1 protein

Gene Name

NGFRAP1

UniProt

Q00994

Expression Region

1-111aa

Organism

Homo sapiens (Human)

Target Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Apoptosis

Relevance

May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death . May play an important role in the pathogenesis of neurogenetic diseases.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death (By similarity) . May play an important role in the pathogenesis of neurogenetic diseases.

Molecular Weight

15 kDa

References & Citations

Characterization of three abundant mRNAs from human ovarian granulosa cells.Rapp G., Freudenstein J., Klaudiny J., Mucha J., Wempe F., Zimmer M., Scheit K.H.DNA Cell Biol. 9:479-485 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OR1E2 sgRNA gene knockout kit - Lentiviral human OR1E2 sgRNA gene knockout kit (plasmid)
GTR15355480 1 Vial

Lentiviral human OR1E2 sgRNA gene knockout kit - Lentiviral human OR1E2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Transcription coFactor vestigial-Like protein 3 (VGLL3) Human ELISA Kit
H7078 96 Tests

Transcription coFactor vestigial-Like protein 3 (VGLL3) Human ELISA Kit

Sign In for Pricing
View Details
TNFa/TNF-alpha Mouse Monoclonal Antibody
orb2974690-01 50 µg

TNFa/TNF-alpha Mouse Monoclonal Antibody

Sign In for Pricing
View Details
TNFa/TNF-alpha Mouse Monoclonal Antibody
orb2974690-02 100 µg

TNFa/TNF-alpha Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GSK2330672
B8327-50 50 mg

GSK2330672

Sign In for Pricing
View Details
GCDH Assay Kit (UV Spectrophotometry)
CB0232UV 50 Tests

GCDH Assay Kit (UV Spectrophotometry)

Sign In for Pricing
View Details