Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Metallothionein-2 (MT2A), partial

Product Specifications

Product Name Alternative

Metallothionein-2AMetallothionein-II ; MT-II

Abbreviation

Recombinant Human MT2A protein, partial

Gene Name

MT2A

UniProt

P02795

Expression Region

1-59aa

Organism

Homo sapiens (Human)

Target Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.

Molecular Weight

7.9 kDa

References & Citations

Primary structure of human hepatic metallothionein.Kissling M.M., Kaegi J.H.R.FEBS Lett. 82:247-250 (1977)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMG4 (NM_001128592) Human Over-expression Lysate
LY426965 100 µg

PSMG4 (NM_001128592) Human Over-expression Lysate

Sign In for Pricing
View Details
DPP10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A5]
TA503585BM 100 µL

DPP10 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1A5]

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF488A conjugate, 0.1mg/mL
BNC882113-500 1x 500 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OTC Polyclonal Antibody
E-AB-15274-01 20 µL

OTC Polyclonal Antibody

Sign In for Pricing
View Details
OTC Polyclonal Antibody
E-AB-15274-02 60 µL

OTC Polyclonal Antibody

Sign In for Pricing
View Details
OTC Polyclonal Antibody
E-AB-15274-03 120 µL

OTC Polyclonal Antibody

Sign In for Pricing
View Details