Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mesothelin (Msln), partial

Product Specifications

Product Name Alternative

Pre-pro-megakaryocyte-potentiating factor

Abbreviation

Recombinant Mouse Msln protein, partial

Gene Name

Msln

UniProt

Q61468

Expression Region

298-600aa

Organism

Mus musculus (Mouse)

Target Sequence

DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Mbrane-anchored forms may play a role in cellular adhesion.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Membrane-anchored forms may play a role in cellular adhesion.

Molecular Weight

36.1 kDa

References & Citations

Stromelysin-1 and mesothelin are differentially regulated by Wnt-5a and Wnt-1 in C57mg mouse mammary epithelial cells.Prieve M.G., Moon R.T.BMC Dev. Biol. 3:2-2 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2118510-01 0.1 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2118510-02 0.2 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2118510-03 0.5 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2118510-04 1 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2118510-05 5 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)
MBS2118510-06 5x 5 mL

PE-Linked Polyclonal Antibody to Protein Tyrosine Phosphatase Receptor Type C (CD45)

Sign In for Pricing
View Details