Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix metalloproteinase-9 (MMP9), partial

Product Specifications

Product Name Alternative

92KDA gelatinase92KDA type IV collagenaseGelatinase B ; GELB

Abbreviation

Recombinant Human MMP9 protein, partial

Gene Name

MMP9

UniProt

P14780

Expression Region

107-707aa

Organism

Homo sapiens (Human)

Target Sequence

FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Developmental Biology

Relevance

May play an essential role in local proteolysis of the Extracellular domain matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.

Molecular Weight

68.6 kDa

References & Citations

SV40-transformed human lung fibroblasts secrete a 92-KDA type IV collagenase which is identical to that secreted by normal human macrophages.Wilhelm S.M., Collier I.E., Marmer B.L., Eisen A.Z., Grant G.A., Goldberg G.I.J. Biol. Chem. 264:17213-17221 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein G PCR Plates - non skirted
PCR960109-PG 10 Plates

Protein G PCR Plates - non skirted

Sign In for Pricing
View Details
Cdh26 Mouse Gene Knockout Kit (CRISPR)
KN503012 1 Kit

Cdh26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zfp263 Mouse Gene Knockout Kit (CRISPR)
KN519762 1 Kit

Zfp263 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Nitrosopyrrolidine-2-carboxylic Acid
TRC-N497885-250MG 250 mg

1-Nitrosopyrrolidine-2-carboxylic Acid

Sign In for Pricing
View Details
Uncoated Human LIF (Leukemia Inhibitory Factor) ELISA Kit
E-UNEL-H0270-01 5x 96 Tests

Uncoated Human LIF (Leukemia Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human LIF (Leukemia Inhibitory Factor) ELISA Kit
E-UNEL-H0270-02 15x 96 Tests

Uncoated Human LIF (Leukemia Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details