Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial

Product Specifications

Product Name Alternative

Antigen identified by monoclonal Ki 67 ; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67 ; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen ; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2

Abbreviation

Recombinant Human MKI67 protein, partial

Gene Name

MKI67

UniProt

P46013

Expression Region

3120-3256aa

Organism

Homo sapiens (Human)

Target Sequence

NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cell Cycle

Relevance

Thought to be required for maintaining cell proliferation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly

Molecular Weight

17.3 kDa

References & Citations

A novel nucleolar protein, NIFK, interacts with the forkhead associated domain of Ki-67 antigen in mitosis.Takagi M., Sueishi M., Saiwaki T., Kametaka A., Yoneda Y.J. Biol. Chem. 276:25386-25391 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yttrium acetylacetonate
Y00320-01 5 g

Yttrium acetylacetonate

Sign In for Pricing
View Details
Yttrium acetylacetonate
Y00320-02 25 g

Yttrium acetylacetonate

Sign In for Pricing
View Details
OR8D4 Protein Vector (Human) (pPM-C-HA)
35665021 500 ng

OR8D4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Porcine AP 1 complex subunit sigma 2 (AP1S2) ELISA kit
GTR10474740 96 Well

Porcine AP 1 complex subunit sigma 2 (AP1S2) ELISA kit

Sign In for Pricing
View Details
PDCD1 (Programmed Cell Death 1, PD-1, CD279) (APC) discontinued
145565 100 Tests

PDCD1 (Programmed Cell Death 1, PD-1, CD279) (APC) discontinued

Sign In for Pricing
View Details
RPS26P42 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2052406 1.0 µg DNA

RPS26P42 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details