Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial
Product Specifications
Product Name Alternative
Antigen identified by monoclonal Ki 67 ; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67 ; Antigen Ki67; KI67_HUMAN; KIA; Marker of proliferation Ki-67; MIB 1; MIB; MKI67; PPP1R105; Proliferation marker protein Ki-67; Proliferation related Ki 67 antigen ; Protein phosphatase 1 regulatory subunit 105; RP11-380J17.2
Abbreviation
Recombinant Human MKI67 protein, partial
Gene Name
MKI67
UniProt
P46013
Expression Region
3120-3256aa
Organism
Homo sapiens (Human)
Target Sequence
NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI
Tag
N-terminal 6xHis-tagged
Type
In Stock Protein
Source
Yeast
Field of Research
Cell Cycle
Relevance
Thought to be required for maintaining cell proliferation.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Molecular Weight
17.3 kDa
References & Citations
A novel nucleolar protein, NIFK, interacts with the forkhead associated domain of Ki-67 antigen in mitosis.Takagi M., Sueishi M., Saiwaki T., Kametaka A., Yoneda Y.J. Biol. Chem. 276:25386-25391 (2001)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
036099-APC 200 µL
GLT25D2, NT (GLT25D2, C1orf17, KIAA0584, Procollagen galactosyltransferase 2, Glycosyltransferase 25 family member 2, Hydroxylysine galactosyltransferase 2) (APC) discontinued
Sign In for Pricing
View Details 
036467-ML550 100 µL
HCK, NT (HCK, Tyrosine-protein kinase HCK, Hematopoietic cell kinase, Hemopoietic cell kinase, p59-HCK/p60-HCK, p59Hck, p61Hck) (MaxLight 550) discontinued
Sign In for Pricing
View Details bs-3192R-PE-Cy5-TR 20 µL
Phospho-IRAK1 (Ser376) Polyclonal Antibody, PE-Cy5 Conjugated
Sign In for Pricing
View Details RC239552A1V 250 µL
Human Hsp105 (HSPH1) (NM_001286505) AAV Particle
Sign In for Pricing
View Details