Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galectin-7 (Lgals7)

Product Specifications

Product Name Alternative

Lgals7; Galectin-7; Gal-7

Abbreviation

Recombinant Mouse Lgals7 protein

Gene Name

Lgals7

UniProt

O54974

Expression Region

2-136aa

Organism

Mus musculus (Mouse)

Target Sequence

SATHHKTSLPQGVRVGTVMRIRGLVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVFNTKQQGKWGREERGTGIPFQRGQPFEVLLIATEEGFKAVVGDDEYLHFHHRLPPARVRLVEVGGDVQLHSLNIF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release (By similarity) .

Molecular Weight

17 kDa

References & Citations

Galectin-7, a marker of all types of stratified epithelia.Magnaldo T., Fowlis D., Darmon M.Differentiation 63:159-168 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Proprotein Convertase Subtilisin/Kexin Type 5 (PCSK5) ELISA Kit
MBS162663-01 48 Well

Mouse Proprotein Convertase Subtilisin/Kexin Type 5 (PCSK5) ELISA Kit

Sign In for Pricing
View Details
Mouse Proprotein Convertase Subtilisin/Kexin Type 5 (PCSK5) ELISA Kit
MBS162663-02 96 Well

Mouse Proprotein Convertase Subtilisin/Kexin Type 5 (PCSK5) ELISA Kit

Sign In for Pricing
View Details
Mouse Proprotein Convertase Subtilisin/Kexin Type 5 (PCSK5) ELISA Kit
MBS162663-03 5x 96 Well

Mouse Proprotein Convertase Subtilisin/Kexin Type 5 (PCSK5) ELISA Kit

Sign In for Pricing
View Details
Mouse Proprotein Convertase Subtilisin/Kexin Type 5 (PCSK5) ELISA Kit
MBS162663-04 10x 96 Well

Mouse Proprotein Convertase Subtilisin/Kexin Type 5 (PCSK5) ELISA Kit

Sign In for Pricing
View Details
2'-C-Methylcytidine
C03692-5mg 5 mg

2'-C-Methylcytidine

Sign In for Pricing
View Details
Recombinant Human LRP12/ST7 Protein, C-Fc
orb2833274-01 20 µg

Recombinant Human LRP12/ST7 Protein, C-Fc

Sign In for Pricing
View Details