Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Scaffold protein D13 (D13L), partial

Product Specifications

Product Name Alternative

(62 kDa protein) (Rifampicin resistance protein)

Abbreviation

Recombinant Vaccinia virus D13L protein, partial

Gene Name

D13L

UniProt

P68441

Expression Region

1-230aa

Organism

Vaccinia virus (strain Copenhagen) (VACV)

Target Sequence

MNNTIINSLIGGDDSIKRSNVFAVDSQIPTLYMPQYISLSGVMTNDGPDNQAIASFEIRDQYITALNHLVLSLELPEVKGMGRFGYVPYVGYKCINHVSISSCNGVIWEIEGEELYNNCINNTIALKHSGYSSELNDISIGLTPNDTIKEPSTVYVYIKTPFDVEDTFSSLKLSDSKITVTVTFNPVSDIVIRDSSFDFETFNKEFVYVPELSFIGYMVKNVQIKPSFIE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Scaffold protein which forms a transitory spherical honeycomb lattice providing curvature and rigidity to the convex membrane of crescent and immature virions (IV) . This association occurs concomitantly with viral membrane formation. Targeted by the drug rifampicin, which prevents the formation of this lattice, and hence virus morphogenesis. In the presence of rifampicin, irregularly shaped membranes that lack the honeycomb layer accumulate around areas of electron-dense viroplasm. This layer is lost from virions during maturation from IV to mature virion (MV), through the proteolysis of A17 N-terminus.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.2 kDa

References & Citations

"The complete DNA sequence of vaccinia virus." Goebel S.J., Johnson G.P., Perkus M.E., Davis S.W., Winslow J.P., Paoletti E. Virology 179:247-266 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR2 Recombinant Antibody, APC-Cy7 Conjugated
bsm-54147R-APC-Cy7 100 µL

TLR2 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Caveolin 1 Antibody
MBS8580389-01 0.1 mL

Caveolin 1 Antibody

Sign In for Pricing
View Details
Caveolin 1 Antibody
MBS8580389-02 0.1 mL (AF635)

Caveolin 1 Antibody

Sign In for Pricing
View Details
Caveolin 1 Antibody
MBS8580389-03 0.1 mL (AF610)

Caveolin 1 Antibody

Sign In for Pricing
View Details
Caveolin 1 Antibody
MBS8580389-04 0.1 mL (AF405S)

Caveolin 1 Antibody

Sign In for Pricing
View Details
Caveolin 1 Antibody
MBS8580389-05 0.1 mL (AF405L)

Caveolin 1 Antibody

Sign In for Pricing
View Details