Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Interleukin-1 beta (IL1B)

Product Specifications

Product Name Alternative

IL1BInterleukin-1 beta; IL-1 beta

Abbreviation

Recombinant Sheep IL1B protein

Gene Name

IL1B

UniProt

P21621

Expression Region

114-266aa

Organism

Ovis aries (Sheep)

Target Sequence

AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.

Molecular Weight

19.7 kDa

References & Citations

Nucleotide sequence of ovine interleukin-1 beta.Fiskerstrand C., Sargan D.Nucleic Acids Res. 18:7165-7165 (1990)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phencyclidine (PCP)
P3380-10 1 mg

Phencyclidine (PCP)

Sign In for Pricing
View Details
PTEN, Phosphorylated (Y240) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 405)
MBS6338628-01 0.1 mL

PTEN, Phosphorylated (Y240) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 405)

Sign In for Pricing
View Details
PTEN, Phosphorylated (Y240) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 405)
MBS6338628-02 5x 0.1 mL

PTEN, Phosphorylated (Y240) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 405)

Sign In for Pricing
View Details
Human Sodium/bile acid cotransporter (SLC10A1) ELISA Kit
orb1656155-01 48 Tests

Human Sodium/bile acid cotransporter (SLC10A1) ELISA Kit

Sign In for Pricing
View Details
Human Sodium/bile acid cotransporter (SLC10A1) ELISA Kit
orb1656155-02 96 Tests

Human Sodium/bile acid cotransporter (SLC10A1) ELISA Kit

Sign In for Pricing
View Details
Mouse Myotrophin (MTPN) ELISA Kit-Sandwich
EK6F356-01 48 Test

Mouse Myotrophin (MTPN) ELISA Kit-Sandwich

Sign In for Pricing
View Details