Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1 Protein, Human (D239E, L241E, HEK293)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (D239E, L241E, HEK293) is the recombinant human-derived IgG1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (D239E, L241E, HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg1-protein-human-d239e-l241e-hek293.html

Purity

98.0

Smiles

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQTLPPSREEETKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (D104-K330, D239E, L241E) (Accession)

Molecular Weight

Approximately 32-34 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PP2A-β
Y021405 100 µg

Anti-PP2A-β

Sign In for Pricing
View Details
AP2A1 Antibody
orb3053136-01 50 µL

AP2A1 Antibody

Sign In for Pricing
View Details
AP2A1 Antibody
orb3053136-02 100 µL

AP2A1 Antibody

Sign In for Pricing
View Details
SLU7 Recombinant Protein Antigen
NBP2-58665PEP 100 µL

SLU7 Recombinant Protein Antigen

Sign In for Pricing
View Details
Bcl-2 (B-cell CLL/Lymphoma 2)
307425 100 µL

Bcl-2 (B-cell CLL/Lymphoma 2)

Sign In for Pricing
View Details
Antarctic Phosphatase
D7028M 5000 U

Antarctic Phosphatase

Sign In for Pricing
View Details