Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Interleukin-15 (IL15)

Product Specifications

Product Name Alternative

IL15; Interleukin-15; IL-15

Abbreviation

Recombinant Rhesus macaque IL15 protein

Gene Name

IL15

UniProt

P48092

Expression Region

49-162aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISHESGDTDIHDTVENLIILANNILSSNGNITESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

Molecular Weight

14.9 kDa

References & Citations

"Comparative sequence analysis of cytokine genes from human and nonhuman primates."Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A.J. Immunol. 155:3946-3954 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cwc15 (NM_023153) Mouse Recombinant Protein
E45M48062M5 20 µg

Cwc15 (NM_023153) Mouse Recombinant Protein

Sign In for Pricing
View Details
Mmu-miR-6906-5p miRNA Inhibitor
orb1869641-01 10 nmol

Mmu-miR-6906-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-6906-5p miRNA Inhibitor
orb1869641-02 20 nmol

Mmu-miR-6906-5p miRNA Inhibitor

Sign In for Pricing
View Details
Streptavidin Coated Plates, Clear, 12x8-Well Strips, White Frame
orb750374-01 5 Plate

Streptavidin Coated Plates, Clear, 12x8-Well Strips, White Frame

Sign In for Pricing
View Details
Streptavidin Coated Plates, Clear, 12x8-Well Strips, White Frame
orb750374-02 1 Plate

Streptavidin Coated Plates, Clear, 12x8-Well Strips, White Frame

Sign In for Pricing
View Details
WDR58 (THOC6) Human Gene Knockout Kit (CRISPR)
KN408694 1 Kit

WDR58 (THOC6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details