Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Heme oxygenase 1 (Hmox1)

Product Specifications

Product Name Alternative

P32 protein

Abbreviation

Recombinant Mouse Hmox1 protein

Gene Name

Hmox1

UniProt

P14901

Expression Region

1-289aa

Organism

Mus musculus (Mouse)

Target Sequence

MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMKNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEIIPCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQDTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLATVAVGIYAM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

He oxygenase cleaves the he ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of he oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free he sensitizes cells to undergo apoptosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Molecular Weight

34.9 kDa

References & Citations

Isolation and characterization of a complementary DNA clone for a Mr 32,000 protein which is induced with tumor promoters in BALB/c 3T3 cells.Kageyama H., Hiwasa T., Tokunaga K., Sakiyama S.Cancer Res. 48:4795-4798 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF40A Polyclonal Antibody
E-AB-53091-01 20 µL

PRPF40A Polyclonal Antibody

Sign In for Pricing
View Details
PRPF40A Polyclonal Antibody
E-AB-53091-02 60 µL

PRPF40A Polyclonal Antibody

Sign In for Pricing
View Details
PRPF40A Polyclonal Antibody
E-AB-53091-03 120 µL

PRPF40A Polyclonal Antibody

Sign In for Pricing
View Details
PRPF40A Polyclonal Antibody
E-AB-53091-04 200 µL

PRPF40A Polyclonal Antibody

Sign In for Pricing
View Details
TMEM85 (EMC4) (N-term) Rabbit Polyclonal Antibody
AP54293PU-N 400 µL

TMEM85 (EMC4) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Arylsulfatase B (ARSB) ELISA Kit
RDR-ARSB-Hu-01 96 Tests

Human Arylsulfatase B (ARSB) ELISA Kit

Sign In for Pricing
View Details