Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Hemoglobin subunit alpha (Hba)

Product Specifications

Product Name Alternative

Alpha-globinHemoglobin alpha chain

Abbreviation

Recombinant Mouse Hba protein

Gene Name

Hba

UniProt

P01942

Expression Region

2-142aa

Organism

Mus musculus (Mouse)

Target Sequence

VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Involved in oxygen transport from the lung to the various peripheral tissues.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in oxygen transport from the lung to the various peripheral tissues.

Molecular Weight

17 kDa

References & Citations

The complete sequence of a chromosomal mouse alpha-globin gene reveals elements conserved throughout vertebrate evolution.Nishioka Y., Leder P.Cell 18:875-882 (1979)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta 1 Recombinant Antbody Kit (KD-Validated)
bsm-90415R-01 50 µL

TGF beta 1 Recombinant Antbody Kit (KD-Validated)

Sign In for Pricing
View Details
TGF beta 1 Recombinant Antbody Kit (KD-Validated)
bsm-90415R-02 50μL Ab + 25μg cell Lysate + 25μg WT cell

TGF beta 1 Recombinant Antbody Kit (KD-Validated)

Sign In for Pricing
View Details
Anti-TIGIT Neutralizing Antibody
71340 100 µg

Anti-TIGIT Neutralizing Antibody

Sign In for Pricing
View Details
Anti-GSTM2 Antibody Picoband® Fluoro647 Conjugated
A04423-3-Fluoro647 100 µg/Vial

Anti-GSTM2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
2- (Acetylamino) benzenecarboxamide
sc-298130A 5 mg

2- (Acetylamino) benzenecarboxamide

Sign In for Pricing
View Details
Mouse Monoclonal HSD17B8 Antibody (OTI2E12) [Alexa Fluor 350]
NBP2-71350AF350 0.1 mL

Mouse Monoclonal HSD17B8 Antibody (OTI2E12) [Alexa Fluor 350]

Sign In for Pricing
View Details