Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Guanylate cyclase activator 2B (Guca2b)

Product Specifications

Product Name Alternative

Guca2b; Guanylate cyclase activator 2B [Cleaved into: Uroguanylin; UGN) ]

Abbreviation

Recombinant Mouse Guca2b protein

Gene Name

Guca2b

UniProt

O09051

Expression Region

22-106aa

Organism

Mus musculus (Mouse)

Target Sequence

VYIKYHGFQVQLESVKKLNELEEKEMSNPQPRRSGLLPAVCHNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport (By similarity) .

Molecular Weight

11.4 kDa

References & Citations

Uroguanylin and guanylin distinct but overlapping patterns of messenger RNA expression in mouse intestine.Whitaker T.L., Witte D.P., Scott M.C., Cohen M.B.Gastroenterology 113:1000-1006 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-(Diethylboryl)pyridine
TRC-D442040-1G 1 g

3-(Diethylboryl)pyridine

Sign In for Pricing
View Details
PCNA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F9]
TA800883BM 100 µL

PCNA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F9]

Sign In for Pricing
View Details
High Temperature High Shear Viscometer BPTL-104
BPTL-104 1 Unit

High Temperature High Shear Viscometer BPTL-104

Sign In for Pricing
View Details
KIAA2026 Human Gene Knockout Kit (CRISPR)
KN220620LP 1 Kit

KIAA2026 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Concanavalin A, CF®770 Conjugate
#29058 5x 1 mg

Concanavalin A, CF®770 Conjugate

Sign In for Pricing
View Details
Ang5 Mouse Gene Knockout Kit (CRISPR)
KN501232 1 Kit

Ang5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details