Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glypican-6 (GPC6)

Product Specifications

Product Name Alternative

GPC 6; Glypican 6 [Precursor]; Glypican proteoglycan 6; Gpc6; GPC6_HUMAN; MGC126288 ; OMIMD1; PRO705; Secreted glypican 6; Secreted glypican-6; UNQ369

Abbreviation

Recombinant Human GPC6 protein

Gene Name

GPC6

UniProt

Q9Y625

Expression Region

24-529aa

Organism

Homo sapiens (Human)

Target Sequence

DVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTEMEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQDLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQVTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLANQADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, Extracellular domain matrix proteins, proteases and anti-proteases . Enhances migration and invasion of cancer cells through WNT5A signaling.1 Publication

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cell surface proteoglycan that bears heparan sulfate. Putative cell surface coreceptor for growth factors, extracellular matrix proteins, proteases and anti-proteases (By similarity) . Enhances migration and invasion of cancer cells through WNT5A signaling.

Molecular Weight

59.6 kDa

References & Citations

GPC6, a novel member of the glypican gene family, encodes a product structurally related to GPC4 and is colocalized with GPC5 on human chromosome 13.Paine-Saunders S., Viviano B.L., Saunders S.Genomics 57:455-458 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALML4 Lentiviral Activation Particles (m)
sc-429139-LAC 200 µL

CALML4 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
PcDNA3.1 (+) -3*HA-FANCE
PPL01879-2a 1 Each

PcDNA3.1 (+) -3*HA-FANCE

Sign In for Pricing
View Details
Cat Atrophin-1 (ATN1) ELISA Kit
MBS9931525 Inquire

Cat Atrophin-1 (ATN1) ELISA Kit

Sign In for Pricing
View Details
Sonelokimab Biosimilar, Research Grade
ABS-334-1mg 1 mg

Sonelokimab Biosimilar, Research Grade

Sign In for Pricing
View Details
FAM78A Rabbit Polyclonal Antibody
orb514095 100 µg

FAM78A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Butyrylamino-3-methyl-5-nitrobenzoic Acid Methyl Ester
431352-01 1 g

4-Butyrylamino-3-methyl-5-nitrobenzoic Acid Methyl Ester

Sign In for Pricing
View Details