Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-glucagon (GCG), partial

Product Specifications

Product Name Alternative

Incretin hormoneGlucagon-like peptide 1 (7-37) ; GLP-1 (7-37) Glucagon-like peptide 1 (7-36) ; GLP-1 (7-36) Glucagon-like peptide 2 ; GLP-2

Abbreviation

Recombinant Human GCG protein, partial

Gene Name

GCG

UniProt

P01275

Expression Region

53-89aa

Organism

Homo sapiens (Human)

Target Sequence

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Metabolism

Relevance

Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycia. Plays an important role in initiating and maintaining hyperglycic conditions in diabetes.GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferation. Inhibits beta cell apoptosis.GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability.Oxyntomodulin significantly reduces food intake. Inhibits gastric ptying in humans. Suppression of gastric ptying may lead to increased gastric distension, which may contribute to satiety by causing a sensation of fullness.Glicentin may modulate gastric acid secretion and the gastro-pyloro-duodenal activity. May play an important role in intestinal mucosal growth in the early period of life.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.; FUNCTION

Molecular Weight

6.4 kDa

References & Citations

Glucagon gene expression in vertebrate brain.Drucker D.J., Asa S.J. Biol. Chem. 263:13475-13478 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC92 Human Gene Knockout Kit (CRISPR)
KN400932 1 Kit

CCDC92 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAB37 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B1]
TA505314BM 100 µL

RAB37 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B1]

Sign In for Pricing
View Details
AUTS2 (NM_001127231) Human Over-expression Lysate
LC426730 20 µg

AUTS2 (NM_001127231) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C2orf72 activation kit by CRISPRa
GA116899 1 Kit

Human C2orf72 activation kit by CRISPRa

Sign In for Pricing
View Details
HDAC1 Human Gene Knockout Kit (CRISPR)
KN401745 1 Kit

HDAC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2Alpha-Cyano-ethisterone
TRC-C136480-50MG 50 mg

2Alpha-Cyano-ethisterone

Sign In for Pricing
View Details