Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Beta-defensin 126 (DEFB126), partial

Product Specifications

Product Name Alternative

Defensin, beta 126

Abbreviation

Recombinant Pongo pygmaeus DEFB126 protein, partial

Gene Name

DEFB126

UniProt

A4H244

Expression Region

21-63aa

Organism

Pongo pygmaeus (Bornean orangutan)

Target Sequence

SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Has antibacterial activity.Curated

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial cells to form a sperm reservoir until ovulation. Release from the sperm surface during capacitation and ovaluation by an elevation of oviductal fluid pH is unmasking other surface components and allows sperm to penetrate the cumulus matrix and bind to the zona pellucida of the oocyte. In vitro has antimicrobial activity and may inhibit LPS-mediated inflammation (By similarity) .

Molecular Weight

31.9 kDa

References & Citations

Evolution and sequence variation of human beta-defensin genes.Hollox E.J., Armour J.A.L.

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOLLIP Human Gene Knockout Kit (CRISPR)
KN400227 1 Kit

TOLLIP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS708561 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Nemadipine B
TRC-N389800-1G 1 g

Nemadipine B

Sign In for Pricing
View Details
Air-jacketed Multi gas Incubator BIMA-101
BIMA-101 1 Unit

Air-jacketed Multi gas Incubator BIMA-101

Sign In for Pricing
View Details
INCENP Antibody
KC-3242-01 50 μL

INCENP Antibody

Sign In for Pricing
View Details
INCENP Antibody
KC-3242-02 100 µL

INCENP Antibody

Sign In for Pricing
View Details