Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Corticotropin-releasing factor receptor 1 (CRHR1), partial

Product Specifications

Product Name Alternative

Corticotropin-releasing hormone receptor 1 ; CRH-R-1 ; CRH-R1

Abbreviation

Recombinant Human CRHR1 protein, partial

Gene Name

CRHR1

UniProt

P34998

Expression Region

23-121aa

Organism

Homo sapiens (Human)

Target Sequence

ASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin) . Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal bryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin) . Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.

Molecular Weight

13 kDa

References & Citations

Expression cloning of a human corticotropin-releasing-factor receptor.Chen R., Lewis K.A., Perrin M.H., Vale W.W.Proc. Natl. Acad. Sci. U.S.A. 90:8967-8971 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Isofraxidin 5mg
A15671-5 5 mg

Isofraxidin 5mg

Ask
View Details
HLA-DPB1 (HLA Class II Histocompatibility Antigen, DP beta 1 Chain, HLA Class II Histocompatibility Antigen, DP(W4) beta Chain, MHC Class II Antigen DPB1) (MaxLight 650)
MBS6222576-01 0.1 mL

HLA-DPB1 (HLA Class II Histocompatibility Antigen, DP beta 1 Chain, HLA Class II Histocompatibility Antigen, DP(W4) beta Chain, MHC Class II Antigen DPB1) (MaxLight 650)

Ask
View Details
HLA-DPB1 (HLA Class II Histocompatibility Antigen, DP beta 1 Chain, HLA Class II Histocompatibility Antigen, DP(W4) beta Chain, MHC Class II Antigen DPB1) (MaxLight 650)
MBS6222576-02 5x 0.1 mL

HLA-DPB1 (HLA Class II Histocompatibility Antigen, DP beta 1 Chain, HLA Class II Histocompatibility Antigen, DP(W4) beta Chain, MHC Class II Antigen DPB1) (MaxLight 650)

Ask
View Details
2- (4-Methoxy-3-methylbenzoyl) benzoic Acid
413823-01 100 mg

2- (4-Methoxy-3-methylbenzoyl) benzoic Acid

Ask
View Details
2- (4-Methoxy-3-methylbenzoyl) benzoic Acid
413823-02 250 mg

2- (4-Methoxy-3-methylbenzoyl) benzoic Acid

Ask
View Details