Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Collagen alpha-1 (I) chain, partial

Product Specifications

Product Name Alternative

Alpha-1 type I collagen

Abbreviation

Recombinant Rat Col1a1 protein, partial

Gene Name

Col1a1

UniProt

P02454

Expression Region

955-1207aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Type I collagen is a mber of group I collagen (fibrillar forming collagen) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Type I collagen is a member of group I collagen (fibrillar forming collagen) .

Molecular Weight

25.4 kDa

References & Citations

Expression of collagen alpha1 (I) mRNA variants during tooth and bone formation in the rat.Brandsten C., Lundmark C., Christersson C., Hammarstroem L., Wurtz T.J. Dent. Res. 78:11-19 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)
MBS1438282-01 0.02 mg (E-Coli)

Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)
MBS1438282-02 0.1 mg (E-Coli)

Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)
MBS1438282-03 0.02 mg (Yeast)

Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)
MBS1438282-04 0.1 mg (Yeast)

Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)
MBS1438282-05 0.02 mg (Baculovirus)

Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)

Sign In for Pricing
View Details
Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)
MBS1438282-06 1 mg (E-Coli)

Recombinant Mycobacterium paratuberculosis Putative ESAT-6-like protein 11 (MAP_0161)

Sign In for Pricing
View Details