Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Connector enhancer of kinase suppressor of ras 2 (CNKSR2), partial

Product Specifications

Product Name Alternative

CNK homolog protein 2 ; CNK2

Abbreviation

Recombinant Human CNKSR2 protein, partial

Gene Name

CNKSR2

UniProt

Q8WXI2

Expression Region

650-800aa

Organism

Homo sapiens (Human)

Target Sequence

AAEHLDDMNRWLNRINMLTAGYAERERIKQEQDYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEAKHSRLSSTETSQSQSSHEEFRQEVTGSSAVSPIRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSDSAAI

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

May function as an adapter protein or regulator of Ras signaling pathways.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May function as an adapter protein or regulator of Ras signaling pathways.

Molecular Weight

19.1 kDa

References & Citations

Human homologue of Drosophila CNK interacts with Ras effector proteins Raf and Rlf.Lanigan T.M., Liu A., Huang Y.Z., Mei L., Margolis B., Guan K.-L.FASEB J. 17:2048-2060 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)
MBS1314986-01 0.02 mg (E-Coli)

Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)
MBS1314986-02 0.02 mg (Yeast)

Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)
MBS1314986-03 0.1 mg (E-Coli)

Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)
MBS1314986-04 0.1 mg (Yeast)

Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)
MBS1314986-05 0.02 mg (Baculovirus)

Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)

Sign In for Pricing
View Details
Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)
MBS1314986-06 0.02 mg (Mammalian-Cell)

Recombinant Chlorobium tepidum Ribulose bisphosphate carboxylase-like protein (CT1772)

Sign In for Pricing
View Details