Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Clathrin heavy chain 2 (CLTCL1), partial

Product Specifications

Product Name Alternative

Clathrin heavy chain on chromosome 22 ; CLH-22

Abbreviation

Recombinant Human CLTCL1 protein, partial

Gene Name

CLTCL1

UniProt

P53675

Expression Region

1423-1566aa

Organism

Homo sapiens (Human)

Target Sequence

LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Signal Transduction

Relevance

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma mbrane or to the trans-Golgi network .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network (By similarity) .

Molecular Weight

18.8 kDa

References & Citations

Isolation of a new clathrin heavy chain gene with muscle-specific expression from the region commonly deleted in velo-cardio-facial syndrome.Sirotkin H., Morrow B., Dasgupta R., Goldberg R., Patangali S.R., Shi G., Cannizzaro L., Shprintzen R., Weissman S., Kucherlapati R.Hum. Mol. Genet. 5:617-624 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNAB3 Polyclonal Antibody
E-AB-90960-01 60 µL

KCNAB3 Polyclonal Antibody

Sign In for Pricing
View Details
KCNAB3 Polyclonal Antibody
E-AB-90960-02 120 µL

KCNAB3 Polyclonal Antibody

Sign In for Pricing
View Details
KCNAB3 Polyclonal Antibody
E-AB-90960-03 200 µL

KCNAB3 Polyclonal Antibody

Sign In for Pricing
View Details
Sodium Difluoroacetate-13C2
TRC-S655022-1MG 1 mg

Sodium Difluoroacetate-13C2

Sign In for Pricing
View Details
Reg1 Mouse Gene Knockout Kit (CRISPR)
KN514648 1 Kit

Reg1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc8b1 Mouse Gene Knockout Kit (CRISPR)
KN516205 1 Kit

Slc8b1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details