Recombinant Human Clathrin heavy chain 2 (CLTCL1), partial
Product Specifications
Product Name Alternative
Clathrin heavy chain on chromosome 22 ; CLH-22
Abbreviation
Recombinant Human CLTCL1 protein, partial
Gene Name
CLTCL1
UniProt
P53675
Expression Region
1423-1566aa
Organism
Homo sapiens (Human)
Target Sequence
LLVLSPRLDHTWTVSFFSKAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLEKHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEEGKRECF
Tag
N-terminal 6xHis-tagged
Type
Developed Protein
Source
Yeast
Field of Research
Signal Transduction
Relevance
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma mbrane or to the trans-Golgi network .
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles. Two different adapter protein complexes link the clathrin lattice either to the plasma membrane or to the trans-Golgi network (By similarity) .
Molecular Weight
18.8 kDa
References & Citations
Isolation of a new clathrin heavy chain gene with muscle-specific expression from the region commonly deleted in velo-cardio-facial syndrome.Sirotkin H., Morrow B., Dasgupta R., Goldberg R., Patangali S.R., Shi G., Cannizzaro L., Shprintzen R., Weissman S., Kucherlapati R.Hum. Mol. Genet. 5:617-624 (1996)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]](https://cdn.genprice.uk/products/937/68dd1b77061270361ea1a912/imageurl/ta801325am.webp)
TA801325AM 100 µL
ALK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H5]
Sign In for Pricing
View Details 
BNC043111-100 1x 100 µL
ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB2166-100 1x 100 µL
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-H296533-2.5MG 2.5 mg
(3S,4S)-3-Hexyl-4-((S)-2-hydroxypentadecyl)oxetan-2-one
Sign In for Pricing
View Details 