Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Muscarinic acetylcholine receptor M3 (CHRM3), partial

Product Specifications

Product Name Alternative

AChR; ACM3_HUMAN; cholinergic receptor muscarinic 3; CHRM 3; CHRM3; EGBRS; HM 3; HM3; m3 muscarinic acetylcholine receptor; M3 muscarinic receptor; muscarinic 3; Muscarinic acetylcholine receptor M3; muscarinic cholinergic m3 receptor; muscarinic m3 receptor

Abbreviation

Recombinant Human CHRM3 protein, partial

Gene Name

CHRM3

UniProt

P20309

Expression Region

253-492aa

Organism

Homo sapiens (Human)

Target Sequence

RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effect is Pi turnover.

Molecular Weight

28.7 kDa

References & Citations

Distinct primary structures, ligand-binding properties and tissue-specific expression of four human muscarinic acetylcholine receptors.Peralta E.G., Ashkenazi A., Winslow J.W., Smith D.H., Ramachandran J., Capon D.J.EMBO J. 6:3923-3929 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5I (ATP Synthase Subunit E, Mitochondrial,, ATP5K) (MaxLight 550)
MBS6407759-01 0.1 mL

ATP5I (ATP Synthase Subunit E, Mitochondrial,, ATP5K) (MaxLight 550)

Sign In for Pricing
View Details
ATP5I (ATP Synthase Subunit E, Mitochondrial,, ATP5K) (MaxLight 550)
MBS6407759-02 5x 0.1 mL

ATP5I (ATP Synthase Subunit E, Mitochondrial,, ATP5K) (MaxLight 550)

Sign In for Pricing
View Details
Cat Protein MB21D1 (C6ORF150) ELISA Kit
MBS9358671 Inquire

Cat Protein MB21D1 (C6ORF150) ELISA Kit

Sign In for Pricing
View Details
MARCH8 Overexpression Lysate (Native) - (Dry Ice)
NBL1-07137 0.1 mg

MARCH8 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Human 5-HT7 (NP_062874) VersaClone cDNA
RDC0252 10 µg

Human 5-HT7 (NP_062874) VersaClone cDNA

Sign In for Pricing
View Details
Ccdc7 sgRNA CRISPR Lentivector set (Mouse)
K3258201 3x 1.0 µg

Ccdc7 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details