Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histone H3-like centromeric protein A (Cenpa)

Product Specifications

Product Name Alternative

Centromere protein A ; CENP-A

Abbreviation

Recombinant Mouse Cenpa protein

Gene Name

Cenpa

UniProt

O35216

Expression Region

1-134aa

Organism

Mus musculus (Mouse)

Target Sequence

MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assbly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. The CENPA-H4 heterotetramer can bind DNA by itself (in vitro) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Histone H3-like nucleosomal protein that is specifically found in centromeric nucleosomes. Replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. The presence of CENPA subtly modifies the nucleosome structure and the way DNA is wrapped around the nucleosome and gives rise to protruding DNA ends that are less well-ordered and rigid compared to nucleosomes containing histone H3. May serve as an epigenetic mark that propagates centromere identity through replication and cell division (By similarity) . Required for recruitment and assembly of kinetochore proteins, and as a consequence required for progress through mitosis, chromosome segregation and cytokinesis

Molecular Weight

17.5 kDa

References & Citations

Gene structure and sequence analysis of mouse centromere proteins A and C.Kalitsis P., Macdonald A.C., Newson A.J., Hudson D.F., Choo K.H.A.Genomics 47:108-114 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monoclonal DC-SIGN/CD209 Antibody (LWC06) [DyLight 650]
NBP1-43328C 0.1 mL

Rat Monoclonal DC-SIGN/CD209 Antibody (LWC06) [DyLight 650]

Ask
View Details
PAK1 Antibody HRP Conjugated
MBS9460979-01 0.1 mL

PAK1 Antibody HRP Conjugated

Ask
View Details
PAK1 Antibody HRP Conjugated
MBS9460979-02 5x 0.1 mL

PAK1 Antibody HRP Conjugated

Ask
View Details
Hsa-miR-450b-5p miRNA Inhibitor
CIH0645-01 10 nmol

Hsa-miR-450b-5p miRNA Inhibitor

Ask
View Details
Hsa-miR-450b-5p miRNA Inhibitor
CIH0645-02 20 nmol

Hsa-miR-450b-5p miRNA Inhibitor

Ask
View Details
Rat NCOA3/Nuclear Receptor Coactivator 3 ELISA Kit
MBS2889923-01 48 Well

Rat NCOA3/Nuclear Receptor Coactivator 3 ELISA Kit

Ask
View Details