Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD59 glycoprotein (CD59)

Product Specifications

Product Name Alternative

1F5 antigen20KDA homologous restriction factor ; HRF-20 ; HRF20MAC-inhibitory protein ; MAC-IPMEM43 antigen; Membrane attack complex inhibition factor ; MACIFMembrane inhibitor of reactive lysis ; MIRLProtectin; CD59

Abbreviation

Recombinant Human CD59 protein

Gene Name

CD59

UniProt

P13987

Expression Region

26-102aa

Organism

Homo sapiens (Human)

Target Sequence

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

Potent inhibitor of the complent mbrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complents of the assbling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.The soluble form from urine retains its specific complent binding activity, but exhibits greatly reduced ability to inhibit MAC assbly on cell mbranes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase.; FUNCTION

Molecular Weight

11 kDa

References & Citations

CD59, an LY-6-like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells.Davies A., Simmons D.L., Hale G., Harrison R.A., Tighe H., Lachmann P.J., Waldmann H.J. Exp. Med. 170:637-654 (1989)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine DNA Replication Licensing Factor MCM3 ELISA Kit
MBS7261774-01 48 Well

Canine DNA Replication Licensing Factor MCM3 ELISA Kit

Sign In for Pricing
View Details
Canine DNA Replication Licensing Factor MCM3 ELISA Kit
MBS7261774-02 96 Well

Canine DNA Replication Licensing Factor MCM3 ELISA Kit

Sign In for Pricing
View Details
Canine DNA Replication Licensing Factor MCM3 ELISA Kit
MBS7261774-03 5x 96 Well

Canine DNA Replication Licensing Factor MCM3 ELISA Kit

Sign In for Pricing
View Details
Canine DNA Replication Licensing Factor MCM3 ELISA Kit
MBS7261774-04 10x 96 Well

Canine DNA Replication Licensing Factor MCM3 ELISA Kit

Sign In for Pricing
View Details
CKMT1A (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (Not for Export EU)
125021 100 µL

CKMT1A (Creatine Kinase U-type, Mitochondrial, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, Acidic-type Mitochondrial Creatine Kinase, Mia-CK, CKMT1A, CKMT, CKMT1B, CKMT) (Not for Export EU)

Sign In for Pricing
View Details
Lentiviral mouse Rabggta shRNA (UAS) - Lentiviral mouse Rabggta shRNA (UAS, iRFP) (25)
GTR15174974 1 Vial

Lentiviral mouse Rabggta shRNA (UAS) - Lentiviral mouse Rabggta shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details