Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial

Product Specifications

Product Name Alternative

CLM-7 (CD300 antigen-like family member B) (CMRF35-A2) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-Ig-like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM-5)

Abbreviation

Recombinant Human CD300LB protein, partial

Gene Name

CD300LB

UniProt

A8K4G0

Expression Region

18-151aa

Organism

Homo sapiens (Human)

Target Sequence

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.

Molecular Weight

17.2 kDa

References & Citations

"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam50b 3'UTR Luciferase Stable Cell Line
TU106277 1.0 mL

Fam50b 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PEX11B Recombinant Protein (Rat)
RP220073 100 µg

PEX11B Recombinant Protein (Rat)

Sign In for Pricing
View Details
Slide folder, cardboard
513025 10/CS

Slide folder, cardboard

Sign In for Pricing
View Details
NagZ Antibody
orb822798 2 mg

NagZ Antibody

Sign In for Pricing
View Details
CD24, Llama Fc Chimera, Human
Z04177-100 100 µg

CD24, Llama Fc Chimera, Human

Sign In for Pricing
View Details
MAF Polyclonal Antibody
MBS128620-01 0.02 mL

MAF Polyclonal Antibody

Sign In for Pricing
View Details