Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CMRF35-like molecule 7 (CD300LB), partial

Product Specifications

Product Name Alternative

CLM-7 (CD300 antigen-like family member B) (CMRF35-A2) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-Ig-like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM-5)

Abbreviation

Recombinant Human CD300LB protein, partial

Gene Name

CD300LB

UniProt

A8K4G0

Expression Region

18-151aa

Organism

Homo sapiens (Human)

Target Sequence

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.

Molecular Weight

17.2 kDa

References & Citations

"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLA2G2D siRNA (Mouse)
CRM3105-01 15 nmol

PLA2G2D siRNA (Mouse)

Sign In for Pricing
View Details
PLA2G2D siRNA (Mouse)
CRM3105-02 30 nmol

PLA2G2D siRNA (Mouse)

Sign In for Pricing
View Details
TXLNB Rabbit Polyclonal Antibody (FITC)
orb461740 100 µL

TXLNB Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ASPSCR1 (ASPL, RCC17, TUG, UBXD9, UBXN9, Tether Containing UBX Domain for GLUT4, Alveolar Soft Part Sarcoma Chromosomal Region Candidate Gene 1 Protein, Alveolar Soft Part Sarcoma Locus, Renal Papillary Cell Carcinoma Protein 17, UBX Domain-containing Protein 9)
123644 100 µg

ASPSCR1 (ASPL, RCC17, TUG, UBXD9, UBXN9, Tether Containing UBX Domain for GLUT4, Alveolar Soft Part Sarcoma Chromosomal Region Candidate Gene 1 Protein, Alveolar Soft Part Sarcoma Locus, Renal Papillary Cell Carcinoma Protein 17, UBX Domain-containing Protein 9)

Sign In for Pricing
View Details
Azadirachtin
orb1297455-01 1 mg

Azadirachtin

Sign In for Pricing
View Details
Azadirachtin
orb1297455-02 5 mg

Azadirachtin

Sign In for Pricing
View Details