Recombinant Human C-C motif chemokine 8 (CCL8)
Product Specifications
Product Name Alternative
HC14Monocyte chemoattractant protein 2Monocyte chemotactic protein 2 ; MCP-2Small-inducible cytokine A8
Abbreviation
Recombinant Human CCL8 protein
Gene Name
CCL8
UniProt
P80075
Expression Region
24-99aa
Organism
Homo sapiens (Human)
Target Sequence
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Tag
N-terminal 6xHis-tagged
Type
Developed Protein
Source
Yeast
Field of Research
Immunology
Relevance
Chotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2 (6-76) does not show monocyte chotactic activity, but inhibits the chotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
Endotoxin
Not test
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2 (6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
Molecular Weight
10.9 kDa
References & Citations
Complete crystal structure of monocyte chemotactic protein-2, a CC chemokine that interacts with multiple receptors.Blaszczyk J., Coillie E.V., Proost P., Damme J.V., Opdenakker G., Bujacz G.D., Wang J.M., Ji X.Biochemistry 39:14075-14081 (2000)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Full Length of Mature Protein
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682848-100 1x 100 µL
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741030-100 1x 100 µL
CD66 (CEA) (C66/1030), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881091-100 1x 100 µL
PS2 (TFF1/1091), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details