Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 18 (CCL18)

Product Specifications

Product Name Alternative

Alternative macrophage activation-associated CC chemokine 1 ; AMAC-1CC chemokine PAR; CDendritic cell chemokine 1 ; DC-CK1Macrophage inflammatory protein 4 ; MIP-4Pulmonary and activation-regulated chemokine; Small-inducible cytokine A18

Abbreviation

Recombinant Human CCL18 protein

Gene Name

CCL18

UniProt

P55774

Expression Region

21-89aa

Organism

Homo sapiens (Human)

Target Sequence

AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Immunology

Relevance

Chotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.

Molecular Weight

9.9 kDa

References & Citations

Macrophage inflammatory protein-3 and -4.Li H., Ruben S.Patent number US5504003, 02-APR-1996A novel human CC chemokine PARC that is most homologous to macrophage-inflammatory protein-1 alpha/LD78 alpha and chemotactic for T lymphocytes, but not for monocytes.Hieshima K., Imai T., Baba M., Shoudai K., Ishizuka K., Nakagawa T., Tsuruta J., Takeya M., Sakaki Y., Takatsuki K., Miura R., Opdenakker G., van Damme J., Yoshie O., Nomiyama H.J. Immunol. 159:1140-1149 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-100 1x 100 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (6F-H2), CF568 conjugate, 0.1mg/mL
BNC680856-100 1x 100 µL

WT1 (Wilm's Tumor 1) (6F-H2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF640R conjugate, 0.1mg/mL
BNC401856-500 1x 500 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details