Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Carbonic anhydrase 1 (Ca1)

Product Specifications

Product Name Alternative

Carbonate dehydratase I

Abbreviation

Recombinant Rat Ca1 protein

Gene Name

Ca1

UniProt

B0BNN3

Expression Region

2-261aa

Organism

Rattus norvegicus (Rat)

Target Sequence

ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Reversible hydration of carbon dioxide

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Reversible hydration of carbon dioxide.

Molecular Weight

30.2 kDa

References & Citations

Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)
abx309905-01 20 µg

Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)
abx309905-02 50 µg

Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)
abx309905-03 100 µg

Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)
abx309905-04 200 µg

Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)

Sign In for Pricing
View Details
Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)
abx309905-05 1 mg

Coiled-Coil Domain Containing 82 (CCDC82) Antibody (FITC)

Sign In for Pricing
View Details
ELISA Kit For Toll-like receptor 4
E0753m 96 Tests

ELISA Kit For Toll-like receptor 4

Sign In for Pricing
View Details