Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Cholinesterase (BCHE)

Product Specifications

Product Name Alternative

Acylcholine acylhydrolaseButyrylcholine esteraseCholine esterase IIPseudocholinesterase

Abbreviation

Recombinant Dog BCHE protein

Gene Name

BCHE

UniProt

P32750

Expression Region

1-141aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

NTDQSFPGFPGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSVNYRVGALGFLALPGNPEAPGNLGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters (By similarity) .

Molecular Weight

17.1 kDa

References & Citations

Use of the polymerase chain reaction for homology probing of butyrylcholinesterase from several vertebrates.Arpagaus M., Chatonnet A., Masson P., Newton M., Vaughan T.A., Bartels C.F., Nogueira C.P., la Du B.N., Lockridge O.J. Biol. Chem. 266:6966-6974 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)
PDEM100253-01 20 µg

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)
PDEM100253-02 100 µg

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)
PDEM100253-03 500 µg

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)
PDEM100253-04 1 mg

Recombinant Mouse IL-1ra/IL-1F3 protein (His tag)

Sign In for Pricing
View Details
beta Tubulin Mouse Monoclonal Antibody [A1-A4]
M1305-2 100 µL

beta Tubulin Mouse Monoclonal Antibody [A1-A4]

Sign In for Pricing
View Details
iFluor™ 647 Conjugated Vimentin Recombinant Rabbit Monoclonal Antibody [SC60-05]
HA720165F 100 µL

iFluor™ 647 Conjugated Vimentin Recombinant Rabbit Monoclonal Antibody [SC60-05]

Sign In for Pricing
View Details