Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Cholinesterase (BCHE)

Product Specifications

Product Name Alternative

Acylcholine acylhydrolaseButyrylcholine esteraseCholine esterase IIPseudocholinesterase

Abbreviation

Recombinant Dog BCHE protein

Gene Name

BCHE

UniProt

P32750

Expression Region

1-141aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

NTDQSFPGFPGSEMWNPNTDLSEDCLYLNVWIPTPKPKNATVMIWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSVNYRVGALGFLALPGNPEAPGNLGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Esterase with broad substrate specificity. Contributes to the inactivation of the neurotransmitter acetylcholine. Can degrade neurotoxic organophosphate esters (By similarity) .

Molecular Weight

17.1 kDa

References & Citations

Use of the polymerase chain reaction for homology probing of butyrylcholinesterase from several vertebrates.Arpagaus M., Chatonnet A., Masson P., Newton M., Vaughan T.A., Bartels C.F., Nogueira C.P., la Du B.N., Lockridge O.J. Biol. Chem. 266:6966-6974 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dematin (DMTN) Human Gene Knockout Kit (CRISPR)
KN402895 1 Kit

Dematin (DMTN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MINAR2 activation kit by CRISPRa
GA119072 1 Kit

Human MINAR2 activation kit by CRISPRa

Sign In for Pricing
View Details
DNA PKcs (PRKDC) Human Knockdown Lysate
LY300280 100 µg

DNA PKcs (PRKDC) Human Knockdown Lysate

Sign In for Pricing
View Details
Human FOLR1 Recombinant Rabbit monoclonal Antibody
HA723354 100 µL

Human FOLR1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565642 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
E Cadherin (CDH1) Human Gene Knockout Kit (CRISPR)
KN220731 1 Kit

E Cadherin (CDH1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details