Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Annexin A5 (ANXA5)

Product Specifications

Product Name Alternative

Anchorin CII; Annexin V; Annexin-5; Calphobindin I ; CBP-IEndonexin II; Lipocortin V; Placental anticoagulant protein 4 ; PP4Placental anticoagulant protein I ; PAP-I; Thromboplastin inhibitor; Vascular anticoagulant-alpha ; VAC-alpha

Abbreviation

Recombinant Human ANXA5 protein

Gene Name

ANXA5

UniProt

P08758

Expression Region

2-320aa

Organism

Homo sapiens (Human)

Target Sequence

AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cardiovascular

Relevance

This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Molecular Weight

37.8 kDa

References & Citations

Primary structure of human placental anticoagulant protein.Funakoshi T., Hendrickson L.E., McMullen B.A., Fujikawa K.Biochemistry 26:8087-8092 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene M NH₂
HAM1002.25G 25 g

Polystyrene M NH₂

Sign In for Pricing
View Details
CANT1 (N-term) Rabbit Polyclonal Antibody
AP17919PU-N 400 µL

CANT1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CYLD (NM_001042355) Human Recombinant Protein
TP304099 20 µg

CYLD (NM_001042355) Human Recombinant Protein

Sign In for Pricing
View Details
LAGE3 (NM_006014) Human Over-expression Lysate
LY401824 100 µg

LAGE3 (NM_006014) Human Over-expression Lysate

Sign In for Pricing
View Details
SEC24C Rabbit Polyclonal Antibody
TA362694 100 µL

SEC24C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF640R conjugate, 0.1mg/mL
BNC400820-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details