Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cynops pyrrhogaster Annexin A5

Product Specifications

Product Name Alternative

Annexin A5; Annexin V; Annexin-5

Abbreviation

Recombinant Cynops pyrrhogaster Annexin A5 protein

UniProt

P70075

Expression Region

1-323aa

Organism

Cynops pyrrhogaster (Japanese fire-bellied newt)

Target Sequence

MACLKGAKGTVQDAPDFNDKEDAETLRHAMKGLGTDEDTILKLLISRSNKQRQQIALTYKTLFGRDLTDDLKSELSGKFETLLVALMVPAHLYDACELRNAIKGLGTLENVIIEIMASRTAAEVKNIKETYKKEFDSDLEKDIVGDTSGNFERLLVSLVQANRDPVGKVDEGQVENDAKALFDAGENKWGTDEETFISILSTRGVGHLRKVFDQYMTISGYQIEESIQSETGGHFEKLLLAVVKSIRSIQGYLAE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Calcium/phospholipid-binding protein which promotes mbrane fusion and is involved in exocytosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Molecular Weight

30.3 kDa

References & Citations

Differential expression of annexin V during spermatogenesis in the newt Cynops pyrrhogaster.Yamamoto T., Hikono T., Abe S.Dev. Genes Evol. 206:64-71 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GDAP1L1 Antibody (OTI1G5) - Azide and BSA Free
NBP2-72182 100 µg

Mouse Monoclonal GDAP1L1 Antibody (OTI1G5) - Azide and BSA Free

Sign In for Pricing
View Details
Rabbit Spexin, C12orf39 ELISA KIT
E0394Rb-01 48 Well

Rabbit Spexin, C12orf39 ELISA KIT

Sign In for Pricing
View Details
Rabbit Spexin, C12orf39 ELISA KIT
E0394Rb-02 96 Well

Rabbit Spexin, C12orf39 ELISA KIT

Sign In for Pricing
View Details
Rabbit Spexin, C12orf39 ELISA KIT
E0394Rb-03 5x 96 Tests

Rabbit Spexin, C12orf39 ELISA KIT

Sign In for Pricing
View Details
Rabbit Spexin, C12orf39 ELISA KIT
E0394Rb-04 10x 96 Tests

Rabbit Spexin, C12orf39 ELISA KIT

Sign In for Pricing
View Details
Synaptotagmin 1/2 phospho-Ser309/306 Rabbit Polyclonal Antibody
E53P01756 100 µL

Synaptotagmin 1/2 phospho-Ser309/306 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details