Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Allograft inflammatory factor 1 (Aif1)

Product Specifications

Product Name Alternative

Ionized calcium-binding adapter molecule 1 MRF-1 Microglia response factor

Abbreviation

Recombinant Rat Aif1 protein

Gene Name

Aif1

UniProt

P55009

Expression Region

2-147aa

Organism

Rattus norvegicus (Rat)

Target Sequence

SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity) .

Molecular Weight

18.7 kDa

References & Citations

"The genomic sequence and comparative analysis of the rat major histocompatibility complex."Hurt P., Walter L., Sudbrak R., Klages S., Mueller I., Shiina T., Inoko H., Lehrach H., Guenther E., Reinhardt R., Himmelbauer H.Genome Res. 14:631-639 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Serpinb8 activation kit by CRISPRa
GA204068 1 Kit

Mouse Serpinb8 activation kit by CRISPRa

Sign In for Pricing
View Details
BLM Human Gene Knockout Kit (CRISPR)
KN416075 1 Kit

BLM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRRC61 (NM_001142928) Human Over-expression Lysate
LC428296 20 µg

LRRC61 (NM_001142928) Human Over-expression Lysate

Sign In for Pricing
View Details
Cefotiam Dihydrochloride
TRC-C243005-250MG 250 mg

Cefotiam Dihydrochloride

Sign In for Pricing
View Details
SNAIL (SNAI1) Mouse Monoclonal Antibody [Clone ID: 6D2]
AM06589SU-N 100 µL

SNAIL (SNAI1) Mouse Monoclonal Antibody [Clone ID: 6D2]

Sign In for Pricing
View Details
Spop Rabbit Polyclonal Antibody
TA381954 100 µL

Spop Rabbit Polyclonal Antibody

Sign In for Pricing
View Details