Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptomyces avidinii Streptavidin

Product Specifications

Product Name Alternative

; Streptavidin

Abbreviation

Recombinant Streptomyces avidinii Streptavidin protein

UniProt

P22629

Expression Region

25-183aa

Organism

Streptomyces avidinii

Target Sequence

DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin) .

Molecular Weight

43.5 kDa

References & Citations

Structural studies of binding site tryptophan mutants in the high-affinity streptavidin-biotin complex.Freitag S., le Trong I., Chilkoti A., Klumb L.A., Stayton P.S., Stenkamp R.E.J. Mol. Biol. 279:211-221 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOMM70A (TOMM70) Rabbit Polyclonal Antibody
TA361519 100 µL

TOMM70A (TOMM70) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® 800 maleimide
1378-AAT 1 mg

IFluor® 800 maleimide

Sign In for Pricing
View Details
KEAP1 (NM_203500) Human Over-expression Lysate
LC404250 20 µg

KEAP1 (NM_203500) Human Over-expression Lysate

Sign In for Pricing
View Details
3-(4-Hydroxy-[1,1'-biphenyl]-3-yl)propanoic Acid
TRC-H817620-100MG 100 mg

3-(4-Hydroxy-[1,1'-biphenyl]-3-yl)propanoic Acid

Sign In for Pricing
View Details
DDHD2 (NM_001164234) Human Over-expression Lysate
LC431187 20 µg

DDHD2 (NM_001164234) Human Over-expression Lysate

Sign In for Pricing
View Details
RNF185 (Center) Rabbit Polyclonal Antibody
AP53680PU-N 400 µL

RNF185 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details