Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Interleukin-18 (Il18)

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor ; IFN-gamma-inducing factorInterleukin-1 gamma ; IL-1 gamma

Abbreviation

Recombinant Rat Il18 protein

Gene Name

Il18

UniProt

P97636

Expression Region

37-194aa

Organism

Rattus norvegicus (Rat)

Target Sequence

HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Molecular Weight

22.3 kDa

References & Citations

Cloning of the cDNA for interleukin-18 in PC12 and expression in Escherichia coli.Kim S.-J., Kim C.-S., Song K.-Y., Kim J.-S., Jung K.-S. IL-18 translational inhibition restricts IFN-gamma expression in crescentic glomerulonephritis.Garcia G.E., Xia Y., Ku G., Johnson R.J., Wilson C.B., Feng L.Kidney Int. 64:160-169 (2003)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[Tyr0]-BNP-32, human
E-PP-0319-01 1 mg

[Tyr0]-BNP-32, human

Sign In for Pricing
View Details
[Tyr0]-BNP-32, human
E-PP-0319-02 10 mg

[Tyr0]-BNP-32, human

Sign In for Pricing
View Details
[Tyr0]-BNP-32, human
E-PP-0319-03 5 mg

[Tyr0]-BNP-32, human

Sign In for Pricing
View Details
Recombinant Human POMC Protein, N-GST & C-His
YHB92202 100 μg

Recombinant Human POMC Protein, N-GST & C-His

Sign In for Pricing
View Details
Mouse Macrophage Inflammatory Protein 3 Alpha (MIP-3alpha) ELISA kit
MBS263823-01 48 Well

Mouse Macrophage Inflammatory Protein 3 Alpha (MIP-3alpha) ELISA kit

Sign In for Pricing
View Details
Mouse Macrophage Inflammatory Protein 3 Alpha (MIP-3alpha) ELISA kit
MBS263823-02 96 Well

Mouse Macrophage Inflammatory Protein 3 Alpha (MIP-3alpha) ELISA kit

Sign In for Pricing
View Details