Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18-binding protein (Il18bp)

Product Specifications

Product Name Alternative

Interferon gamma-inducing factor-binding protein

Abbreviation

Recombinant Mouse Il18bp protein

Gene Name

Il18bp

UniProt

Q9Z0M9

Expression Region

29-193aa

Organism

Mus musculus (Mouse)

Target Sequence

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response (By similarity) .

Molecular Weight

22 kDa

References & Citations

Identification of human and mouse homologs of the MC51L-53L-54L family of secreted glycoproteins encoded by the Molluscum contagiosum poxvirus.Xiang Y., Moss B.Virology 257:297-302 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c Abl (ABL1) pTyr134 Rabbit Polyclonal Antibody
AP12550PU-N 400 µL

c Abl (ABL1) pTyr134 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF647 conjugate, 0.1mg/mL
BNC473247-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GOLPH2 (GOLM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B3]
TA504114AM 100 µL

GOLPH2 (GOLM1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B3]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB641342 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/1711), 0.2mg/mL
BNUB1711-100 1x 100 µL

Desmin (Muscle Cell Marker) (DES/1711), 0.2mg/mL

Sign In for Pricing
View Details
CD22 Human Gene Knockout Kit (CRISPR)
KN216939BN 1 Kit

CD22 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details