Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Uncharacterized protein (DCX)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Chicken DCX protein

Gene Name

DCX

UniProt

Q98SS5

Expression Region

1-361aa

Organism

Gallus gallus (Chicken)

Target Sequence

MELDFGHFDERDKASRNMRGTRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANQKAPQSLASSNSAQAKENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDESECRVMKGSPAAATGSKSSPTPQKSSAKSPAPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKVDLYLPLSLDDSDSLGDSM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44 kDa

References & Citations

Screening from a subtracted embryonic chick hindbrain cDNA library identification of genes expressed during hindbrain, midbrain and cranial neural crest development.Christiansen J.H., Coles E.G., Robinson V., Pasini A., Wilkinson D.G.Mech. Dev. 102:119-133 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bosutinib discontinued
262981-01 50 mg

Bosutinib discontinued

Sign In for Pricing
View Details
Bosutinib discontinued
262981-02 100 mg

Bosutinib discontinued

Sign In for Pricing
View Details
Bosutinib discontinued
262981-03 250 mg

Bosutinib discontinued

Sign In for Pricing
View Details
Bosutinib discontinued
262981-04 500 mg

Bosutinib discontinued

Sign In for Pricing
View Details
Bosutinib discontinued
262981-05 1 g

Bosutinib discontinued

Sign In for Pricing
View Details
Fetoprotein, Alpha (Alpha Fetoprotein, Alpha, Alpha-fetoprotein Precursor, AFP, Alpha-1-fetoprotein, Alpha-fetoglobulin, FETA, HPAFP)
F4100-02L 100 µg

Fetoprotein, Alpha (Alpha Fetoprotein, Alpha, Alpha-fetoprotein Precursor, AFP, Alpha-1-fetoprotein, Alpha-fetoglobulin, FETA, HPAFP)

Sign In for Pricing
View Details