Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Uncharacterized protein (DCX)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Chicken DCX protein

Gene Name

DCX

UniProt

Q98SS5

Expression Region

1-361aa

Organism

Gallus gallus (Chicken)

Target Sequence

MELDFGHFDERDKASRNMRGTRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANQKAPQSLASSNSAQAKENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDESECRVMKGSPAAATGSKSSPTPQKSSAKSPAPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKVDLYLPLSLDDSDSLGDSM

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44 kDa

References & Citations

Screening from a subtracted embryonic chick hindbrain cDNA library identification of genes expressed during hindbrain, midbrain and cranial neural crest development.Christiansen J.H., Coles E.G., Robinson V., Pasini A., Wilkinson D.G.Mech. Dev. 102:119-133 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Usp42 shRNA (UAS) - Lentiviral mouse Usp42 shRNA (UAS, iRFP) (25)
GTR15296765 1 Vial

Lentiviral mouse Usp42 shRNA (UAS) - Lentiviral mouse Usp42 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Scalpel Blade StSteel No12
INS4676 100 / PCK

Scalpel Blade StSteel No12

Sign In for Pricing
View Details
SLC18A2 antibody
10R-5804 100 µL

SLC18A2 antibody

Sign In for Pricing
View Details
HSP90A discontinued
537613 100 µL

HSP90A discontinued

Sign In for Pricing
View Details
Rat Cyth4 Pre-designed siRNA Set B
SI203516B 1 Each

Rat Cyth4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
FUSSEL18, CT (SKOR2, CORL2, FUSSEL18, SKI family transcriptional corepressor 2, Functional Smad-suppressing element on chromosome 18, LBX1 corepressor 1-like protein, Ladybird homeobox corepressor 1-like protein) (MaxLight 550)
MBS6300352-01 0.1 mL

FUSSEL18, CT (SKOR2, CORL2, FUSSEL18, SKI family transcriptional corepressor 2, Functional Smad-suppressing element on chromosome 18, LBX1 corepressor 1-like protein, Ladybird homeobox corepressor 1-like protein) (MaxLight 550)

Sign In for Pricing
View Details