Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class I histocompatibility antigen, C alpha chain (HLA-C), partial

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Human HLA-C protein, partial

Gene Name

HLA-C

UniProt

O78179

Expression Region

25-308aa

Organism

Homo sapiens (Human)

Target Sequence

CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Involved in the presentation of foreign antigens to the immune syst.SAAS annotation

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.7 kDa

References & Citations

"HLA-C (*) 03 is a risk factor for cardiomyopathy in Chagas disease."Layrisse Z., Fernandez M.T., Montagnani S., Matos M., Balbas O., Herrera F., Colorado I.A., Catalioti F., Acquatella H.Hum. Immunol. 61:925-929 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Josephin-1 (JOSD1) Antibody
abx036467-01 100 µg

Josephin-1 (JOSD1) Antibody

Sign In for Pricing
View Details
Josephin-1 (JOSD1) Antibody
abx036467-02 1 mg

Josephin-1 (JOSD1) Antibody

Sign In for Pricing
View Details
Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 (AHA1) Antibody (Streptavidin)
abx444568 100 µg

Activator of 90 kDa Heat Shock Protein ATPase Homolog 1 (AHA1) Antibody (Streptavidin)

Sign In for Pricing
View Details
Cpne3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6144005 3x 1.0 µg

Cpne3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
XRCC5 (X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-strand-break Rejoining), X-ray Repair Cross-complementing Protein 5, 86kD Subunit of Ku Antigen, ATP Dependent DNA Helicase 2 Subunit 2, ATP-dependent DNA Helicase II, ATP-dependent DNA Helicase II 80kD Subunit, CTC Box Binding Factor 85kD, CTC85, CTCBF, DNA Repair Protein XRCC5, FLJ39089, G22P2, Ku 80, Ku80, Ku Autoantigen 80kD, Ku 86, Ku86, Ku86 Autoantigen-related Protein 1, KARP1, KARP-1, KUB2, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, NFIV, Thyroid Lupus Autoantigen, TLAA) (MaxLight 750) discontinued
X9505-11-ML750 100 µL

XRCC5 (X Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-strand-break Rejoining), X-ray Repair Cross-complementing Protein 5, 86kD Subunit of Ku Antigen, ATP Dependent DNA Helicase 2 Subunit 2, ATP-dependent DNA Helicase II, ATP-dependent DNA Helicase II 80kD Subunit, CTC Box Binding Factor 85kD, CTC85, CTCBF, DNA Repair Protein XRCC5, FLJ39089, G22P2, Ku 80, Ku80, Ku Autoantigen 80kD, Ku 86, Ku86, Ku86 Autoantigen-related Protein 1, KARP1, KARP-1, KUB2, Lupus Ku Autoantigen Protein p86, Nuclear Factor IV, NFIV, Thyroid Lupus Autoantigen, TLAA) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Mouse Pou2f3 Pre-designed siRNA Set B
SI110937B 1 Each

Mouse Pou2f3 Pre-designed siRNA Set B

Sign In for Pricing
View Details