Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Phosphate-binding protein PstS 1 (pstS1), partial

Product Specifications

Product Name Alternative

Antigen Ag78 Protein antigen B Short name: PAB

Abbreviation

Recombinant Mycobacterium tuberculosis pstS1 protein, partial

Gene Name

PstS1

UniProt

P9WGU0

Expression Region

24-373aa

Organism

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Target Sequence

CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Part of the ABC transporter complex PstSACB involved in phosphate import.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Part of the ABC transporter complex PstSACB involved in phosphate import.

Molecular Weight

39.8 kDa

References & Citations

"Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr811 (NM_146552) Mouse Tagged Lenti ORF Clone
MR213099L4 10 µg

Olfr811 (NM_146552) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Janus Kinase 1 (JAK1) ELISA Kit
RDR-JAK1-Ra-96Tests 96 Tests

Rat Janus Kinase 1 (JAK1) ELISA Kit

Sign In for Pricing
View Details
Recombinant BVDV Glycoprotein E2/gp55 Protein, C-Fc
MBS1582037-01 0.1 mg

Recombinant BVDV Glycoprotein E2/gp55 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant BVDV Glycoprotein E2/gp55 Protein, C-Fc
MBS1582037-02 1 mg

Recombinant BVDV Glycoprotein E2/gp55 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant BVDV Glycoprotein E2/gp55 Protein, C-Fc
MBS1582037-03 5x 1 mg

Recombinant BVDV Glycoprotein E2/gp55 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human IL-18 Receptor Accessory Protein/IL-18RAcP/IL-1R7 (C-6His)
orb1648902-01 10 µg

Recombinant Human IL-18 Receptor Accessory Protein/IL-18RAcP/IL-1R7 (C-6His)

Sign In for Pricing
View Details