Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor alpha-induced protein 8 (TNFAIP8)

Product Specifications

Product Name Alternative

Head and neck tumor and metastasis-related protein; MDC-3.13NF-kappa-B-inducible DED-containing protein ; NDEDSCC-S2TNF-induced protein GG2-1

Abbreviation

Recombinant Human TNFAIP8 protein

Gene Name

TNFAIP8

UniProt

O95379

Expression Region

2-198aa

Organism

Homo sapiens (Human)

Target Sequence

HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Apoptosis

Relevance

Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.

Molecular Weight

49.9 kDa

References & Citations

Vascular endothelial genes that are responsive to tumor necrosis factor-alpha in vitro are expressed in atherosclerotic lesions, including inhibitor of apoptosis protein-1, stannin, and two novel genes.Horrevoets A.J.G., Fontijn R.D., van Zonneveld A.J., de Vries C.J.M., ten Cate J.W., Pannekoek H.Blood 93:3418-3431 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAG2 (NM_000536) Human Tagged ORF Clone Lentiviral Particle
RC205065L3V 200 µL

RAG2 (NM_000536) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LAGE3 Antibody - N-terminal region : Biotin (ARP70749_P050-Biotin)
ARP70749_P050-Biotin 100 µL

LAGE3 Antibody - N-terminal region : Biotin (ARP70749_P050-Biotin)

Sign In for Pricing
View Details
SRI Human
OM302136-01 5 µg

SRI Human

Sign In for Pricing
View Details
SRI Human
OM302136-02 20 µg

SRI Human

Sign In for Pricing
View Details
SRI Human
OM302136-03 1 mg

SRI Human

Sign In for Pricing
View Details
Pdx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7541707 1.0 µg DNA

Pdx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details