Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 8 (MSTN)

Product Specifications

Product Name Alternative

Myostatin

Abbreviation

Recombinant Human MSTN protein

Gene Name

MSTN

UniProt

O14793

Expression Region

267-375aa

Organism

Homo sapiens (Human)

Target Sequence

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Acts specifically as a negative regulator of skeletal muscle growth.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Acts specifically as a negative regulator of skeletal muscle growth.

Molecular Weight

16.4 kDa

References & Citations

Double muscling in cattle due to mutations in the myostatin gene.McPherron A.C., Lee S.-J.Proc. Natl. Acad. Sci. U.S.A. 94:12457-12461 (1997)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
11391111 3x 1.0 µg

ADCY1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Human SYNPO Protein, N-GST
bs-102245P-01 20 µg

Recombinant Human SYNPO Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human SYNPO Protein, N-GST
bs-102245P-02 50 µg

Recombinant Human SYNPO Protein, N-GST

Sign In for Pricing
View Details
Human H2AFX Matched Antibody Pair Set [ABP-S-03392]
ABP-S-03392 5 Plates

Human H2AFX Matched Antibody Pair Set [ABP-S-03392]

Sign In for Pricing
View Details
ARL5B Human shRNA Plasmid Kit (Locus ID 221079)
TL318123 1 Kit

ARL5B Human shRNA Plasmid Kit (Locus ID 221079)

Sign In for Pricing
View Details
2-Chloro-4- (dimethylcarbamoyl) phenylboronic acid
OR1083709 1 Each

2-Chloro-4- (dimethylcarbamoyl) phenylboronic acid

Sign In for Pricing
View Details